PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 237aa    MW: 27456.8 Da    PI: 6.8757
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00607genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l ++++++G  +W++ ++  g+ R++k+c++rw +yl
       AA32G00607 14 KGPWTPLEDQILTNYIRLYGHSNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
       AA32G00607  67 RGNFTPHEEQTIINLHQLLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129412.924961IPR017930Myb domain
SuperFamilySSF466891.43E-2910108IPR009057Homeodomain-like
SMARTSM007172.4E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001679.07E-91661No hitNo description
PROSITE profilePS5129423.94662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2765116IPR009057Homeodomain-like
SMARTSM007174.8E-1466114IPR001005SANT/Myb domain
PfamPF002497.8E-1567112IPR001005SANT/Myb domain
CDDcd001671.73E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRAPCCEKM GMKKGPWTPL EDQILTNYIR LYGHSNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPHEEQTIIN LHQLLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLNNNG  120
DTKDINNIEE AIVVAERSSS PSPQHYSNNN IEISTVTTSG NSNENKNYSI LMDDESFWSE  180
VISVDNSTEN WEKLLEKNNK SYESNSKLLL NNNDMEFWFD LFTTTHTIDE FLDIPNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141138.11e-109PREDICTED: myb-related protein Myb4
RefseqXP_013634894.11e-109PREDICTED: myb-related protein Myb4-like
RefseqXP_013634924.11e-109PREDICTED: myb-related protein Myb4-like
RefseqXP_013655085.11e-109PREDICTED: myb-related protein Myb4-like
RefseqXP_013747195.11e-109PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-74MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0D3C3D01e-109A0A0D3C3D0_BRAOL; Uncharacterized protein
TrEMBLM4DYW11e-109M4DYW1_BRARP; Uncharacterized protein
STRINGBra021708.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-111myb domain protein 14